Here we will post the tentative definitive passages, here we will write drafts, post notes and have discussions.
DEBELLOGALLICO
Of The Gallic Wars
GALLIAESTOMNISDIVISAINPARTESTRESQVARVMVNAINCOLVNTBELGÆALIAMAQVITANITERTIAMQVIIPSORVMLINGVACELTÆNOSTRAGALLIAPPELLANTVR
All of Galia is divided in three parts, one of which Belgians occupy, next Aquitanians, third, who in their toungue Celts, in ours are called Gauls.
That looks nice. 
Danke.
HIOMNESLINGVAINSTITVTISLEGIBVSINTERSEDIFFERVNTGALLOSABAQVITANISGARVNNAFLVMENABELGISMATRONAETSEQVANADIVIDIT
There all languages, institutions and laws differ. Where the Gauls meet the Aquitanians flows the Garunna, the Belgians the Matrona and the Sequana divide.
HORVMOMNIVMFORTISSIMISVNTBELGÆPROPTEREAQVODACVLTVATQVEHVMANITATEPROVINCIÆLONGISSIMEABSVNTMINIMEQVEADEOSMERCATORESSÆPECOMMEANTATQVEEAQVÆADEFFEMINADOSANIMOSPERTINENTIMPORTANT
Now, all of them very strong are Belgians, this given to that from cultivation as well as human provinces very far removed they are, very little that to them merchants know how to get as well as those things which effeminate motivations reach bring.
PROXIMIQVESVNTGERMANISQVITRANSRHENVMINCOLVNTQVIBVSCVMCONTINENTERBELLVMGERVNTQVADECAVSAHELVETIIQVOQVERELIQVOSGALLOSVIRTVTEPRÆCEDVNTQVODFERECOTIDIANISPROELIISCVMGERMANISCONTENDVNTCVMAVTSVISFINIBVSEOSPROHIBENTAVTIPSIINEORVMFINIBVSBELLVMGERVNT
Next they are to the Germans, who occupy the area beyond the Rhenum, with whom continually they make war, for which cause the Helvetians, the inherited Gallic manliness of whom preceding them, with doing daily battle with the Germans contend. As at their borders they repell them, on the other in their own borders they make war.
EORVMVNAPARSQVAMGALLOSOBTINEREDICTVMESTINITIVMCAPITAFLVMINERHODANOCONTINENTVRGARVNNAFLVMINEOCEANOFINIBVSBELGARVMATTINGITETIAMABSEQVANISETHELVETIISFLVMENRHENVMVERGITADSEPTENTRIONES
There then that a part which the Gauls held for themselves it is said starts at the end of where the Rhodano flows, holding along where the Garunna flows, the ocean, the Belgian border, it reaching up to the Sequana and the Helvetian part of the Rhenum river, verging north.
BELGÆABEXTREMISGALLIÆFINIBVSORIVNTVRPERTINENTADINFERIOREMPARTEMFLVMINISRHENISPECTANTINSEPTENTRIONEMETORIENTEMSOLEM
The Belgians from the eastern end of the Gallic borders reach to the lower part of the river Rheni looking northeast.
AQVITANIAAGARVNNAFLVMINEADPYRENAEOSMONTESETEAMPARTEMOCEANIQVAEESTADHISPANIAMPERTINETSPECTATINTEROCCASVMSOLISETSEPTENTRIONES
Aquitania to the Garunna river at the Pyrenees mountains and that part of the ocean that is of Spain reaches, and looks north west.
APVDHELVETIOSLONGENOBILISSIMVSFVITETDITISSIMVSORGETORIXISMMESSALAMPISONECONSVLIBVSREGNICVPIDITATEINDVCTVSCONIVRATIONEMNOBILITATISFECITETCIVITATIPERSVASITVTDEFINIBVSSVISCVMOMNIBVSCOPIISEXIRENT
Among Helvetians, long most noble was, and most distinguished, Orgetorix. It was a lust to reign in M Messala and M Pisone’s counsil that led to a noble pact to be made and the citizenry swayed to their very ends with all their resources to sally.
PERFACILEESSECVMVIRTVTEOMNIBVSPRÆSTARENTTOTIVSGALLIÆIMPERIOPOTIRI
With ease it is, with hold of the excertion given by all of them, that all of Galia they could place under their will.
IDHOCFACILIVSIISPERSVASITQVODVNDIQVELOCINATVRAHELVETIICONTINENTVRVNAEXPARTEFLVMINERHENOLATISSIMOATQVEALTISSIMOQVIAGRVMHELVETIVMAGERMANISDIVIDITALTERAEXPARTEMONTEIVRAALTISSIMOQVIESTINTERSEQVANOSETHELVETIOSTERTIALACVLEMANNOETFLVMINERHODANOQVIPROVINCIAMNOSTRAMABHELVETIISDIVIDIT
It was therefore easy for them to bring their view to bear, as it was said that the natural Helvetian domain holds along from the Rhenum river most wide as well as most high which Helvetian soil from Germans divides, elsewhere from the Iura mountain most high which is in the space between the Sequana and Helvetians, third Lemanno lake and the Rhodano river which provinces ours from the Helvetians divide.
HISREBVSFIEBATVTETMINVSLATEVAGARENTVRETMINVSFACILEFINITIMISBELLVMINFERREPOSSENTQVAEXPARTEHOMINESBELLANDICVPIDIMAGNODOLOREADFICIEBANTVR
These lands were held, and less appealing is it to stray end less easy is it at its borders to make war in, which coming from men who take joy in warring causes great pain.
PROMVLTITVDINEAVTEMHOMINVMETPROGLORIABELLIATQVEFORTITVDINISANGVSTOSSEFINESHABEREARBITRABANTVRQVIINLONGITVDINEMMILIAPASSVMCCXLINLATITVDINEMCLXXXPATEBANT
For the amount of men they were and for the glory of war to the strong narrow their borders they worked through that in length 240 thousand steps in width 180 lay open.
HISREBVSADDVCTIETAVCTORITATEORGETORIGISPERMOTICONSTITVERVNTEAQVÆADPROFICISCENDVMPERTINERENTCOMPARAREIVMENTORVMETCARRORVMQVAMMAXIMVMNVMERVMCOEMERESEMENTESQVAMMAXIMASFACEREVTINITINERECOPIAFRVMENTISVPPETERETCVMPROXIMISCIVITATIBVSPACEMETAMICITIAMCONFIRMARE
These lands dispensed and the authority of Orgetorix ratified they constituted that whatever to profit making reached be pooled together, beasts and trains in greatest numbers acquired, what seeds possible harvested, produce loaded for transport, with neighbouring populations openness and friendship confirmed.
ADEASRESCONFICIENDASBIENNIVMSIBISATISESSEDVXERVNTINTERTIVMANNVMPROFECTIONEMLEGECONFIRMANT
To the acquisition of these assets two years to be achieved were given. In the third year they passed law confirming it.
ADEASRESCONFICIENDASORGETORIXDELIGITVRISSIBILEGATIONEMADCIVITATESSVSCIPITINEOITINEREPERSVADETCASTICOCATAMANTALOEDISFILIOSEQVANOCVIVSPATERREGNVMINSEQVANISMVLTOSANNOSOBTINVERATETASENATVPOPVLIROMANIAMICVSAPPELLATVSERATVTREGNVMINCIVITATESVAOCCVPARETQVODPATERANTEHABVERIT
To the acquisition of these assets Orgetorix they charged. It was his entreaties to populations brought about in those wanderings that brings his views to bear on Castico Catamantaloedix’s son Sequano, whose father’s Sequanian rule is many years having been held and at the high chamber of the Roman people friend was called and rule in his population fell into as father before had.